PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G06200.1
Common NameAtGRF6, F5K7.4, GRF6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 244aa    MW: 28210.6 Da    PI: 8.7959
Description growth-regulating factor 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G06200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-2480124145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  daepgrCrRtDGKkWRCs+++++++k+CErH+hrg++rs+++k +
  AT2G06200.1  80 DAEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSSSRKPP 124
                  79**************************************99875 PP

2QLQ59.69.1e-21641237
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 +FT +Q+++L++Q+l++KyLaan+PvPp+Ll+ i++
  AT2G06200.1  6 PFTESQWEELENQALVFKYLAANMPVPPHLLFLIKR 41
                 8******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-14541IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-15639IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.628641IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.00580124IPR014977WRC domain
PfamPF088792.3E-1981122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MATRIPFTES QWEELENQAL VFKYLAANMP VPPHLLFLIK RPFLFSSSSS SSSSSSFFSP  60
TLSPHFGWNV YEMGMGRKID AEPGRCRRTD GKKWRCSKEA YPDSKYCERH MHRGKNRSSS  120
RKPPPTQFTP NLFLDSSSRR RRSGYMDDFF SIEPSGSIKS CSGSAMEDND DGSCRGINNE  180
EKQPDRHCFI LGTDLRTRER PLMLEEKLKQ RDHDNEEEQG SKRFYRFLDE WPSSKSSVST  240
SLFI
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265531_at0.0
Expression AtlasAT2G06200-
AtGenExpressAT2G06200-
ATTED-IIAT2G06200-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in root, shoot and flower
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G06200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G06200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0605860.0AY060586.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
GenBankAY1255720.0AY125572.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_027759.10.0growth-regulating factor 6
SwissprotQ9ZQ120.0GRF6_ARATH; Growth-regulating factor 6
TrEMBLD7LA611e-144D7LA61_ARALL; Putative uncharacterized protein
STRINGAT2G06200.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141011821
Representative plantOGRP4601684
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  4. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  5. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]